PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P10990_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 27129.4 Da    PI: 8.9422
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P10990_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.82.2e-31959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyeys+
  GSMUA_Achr10P10990_001  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSN 59
                            79***********************************************95 PP

2K-box108.95.7e-36801748100
                   K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                             +  ++ + + ++qqe+akL+ +i+ Lq+ +R+l+G++L+sLs+keL+qLe++Le+s+++iRskK+ell+++ie++qk+e elq++n 
  GSMUA_Achr10P10990_001  80 DaiVDVNSQHYYQQESAKLRHQIQILQNGNRNLMGDSLSSLSVKELKQLENRLERSITRIRSKKHELLFAEIEYMQKRESELQSDNS 166
                             34477778899**************************************************************************** PP

                   K-box  93 aLrkklee 100
                             +Lr+k++e
  GSMUA_Achr10P10990_001 167 YLRAKIAE 174
                             *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.006161IPR002100Transcription factor, MADS-box
CDDcd002651.06E-44278No hitNo description
SuperFamilySSF554559.16E-33274IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.4E-333859IPR002100Transcription factor, MADS-box
PfamPF014863.5E-2886172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.41788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFSS RGRLYEYSNN  60
NIKSTIERYK KACADSSNSD AIVDVNSQHY YQQESAKLRH QIQILQNGNR NLMGDSLSSL  120
SVKELKQLEN RLERSITRIR SKKHELLFAE IEYMQKRESE LQSDNSYLRA KIAENERAQQ  180
LSIMQAGTEY YTLPTFDPRN YYHTNMLEAA ADYSHHQDQT TLHLGYDTKT DSAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q2e-21169169Myocyte-specific enhancer factor 2B
1tqe_R2e-21169169Myocyte-specific enhancer factor 2B
1tqe_S2e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ4333730.0KJ433373.1 Musa acuminata AAA Group cultivar Cavendish AGAMOUS-like MADS-box transcription factor (MADS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421148.11e-174PREDICTED: agamous-like MADS-box protein AGL11
SwissprotQ408721e-104AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLM0RH751e-174M0RH75_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P10990_0011e-173(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.11e-105MIKC_MADS family protein